![]() Enter your DNA/RNA sequence in the box below in FASTA or plaintext format: Calculate Clear Jamie McGowan, 2023. This program calculates the GC content of a given DNA/RNA sequence. The molecular weight of the protein is 12 kg/mol. Home Codon Usage GC Content Reverse Complement Translation Venn Diagram. Recombinant mouse C5a is His-Tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETĬEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLG. The C5a desArg form has a different spectrum of bioactivity to intact C5a. The OligoAnalyzer Tool accommodates DNA, RNA, mixed bases, and a variety of. They act as messengers in carrying information from DNA. Enter your sequence into the Sequence box in the 5’ to 3’ orientation (Figure 2, arrow A). Messenger RNA or mRNA is a single unit of an RNA sequence that is complementary to a DNA molecule. The OligoAnalyzer Tool link is found under the Oligo Design & Handling section. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. Select the OligoAnalyzer Tool from the TOOLS menu on any IDT webpage. For example, if SeqNT is a vector of integers, then so is SeqC. The return sequence, SeqC, is in the same format as SeqNT. ![]() ![]() In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. SeqC seqcomplement (SeqNT) calculates the complementary strand of a DNA or RNA nucleotide sequence. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. The sequence should begin with the start codon (ATG) and be in a multiple of 3 for a complete codon sequence. Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. Input your DNA sequence below to retrieve the translated amino acid sequence. Deoxyribonucleic acid (DNA) is a chemical found in the nucleus of cells and carries the instructions for the. ![]()
0 Comments
Leave a Reply. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |